- SPATA32 Antibody
- Novus Biologicals, a Bio-Techne Brand
- Pricing InfoSupplier PageView Company Product Page
- NBP1-93913
- 0.1 ml (also 25ul)
- AEP2, C17orf46, TEX34, VAD1.2
- This antibody was developed against Recombinant Protein corresponding to amino acids: SVHSNMGLPT PQTFRPWSLN SNCRSFTEEN HVSACHHSIS AQTSKHLFWA NKLIQASEHS LQRAINMQLN NGSAGQPIRS PL
- Immunohistochemistry, Immunohistochemistry-Paraffin
- Human
- Unconjugated
- PBS (pH 7.2) and 40% Glycerol
- SPATA32
- Rabbit
- spermatogenesis associated 32
- Novus Biologicals, a Bio-Techne Brand
- IgG
- Polyclonal
- Immunogen affinity purified
- Primary Antibodies
- Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles
Sequence
SVHSNMGLPTPQTFRPWSLNSNCRSFTEENHVSACHHSISAQTSKHLFWANKLIQASEHSLQRAINMQLNNGSAGQPIRSPL
Specifications/Features
Available conjugates: Unconjugated